PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4289	LEC_LENCO	--NA--	"Lens culinaris orientalis"	Fabaceae	--NA--	Signaling-peptide	"Calcium; Lectin; Manganese; Metal-binding; Signal | Lectin precursor [Contains: Lectin beta chain; Lectin alpha chain]."	--NA--	AHEVHSWSFHSELGGTSSSKQAADADTFYNAAWDPSNKERHIGIDVNSIKSVSTKSWNLQNGERANVVIAFNAATIDAPSSYNVADGFTFFIAPVDTKPQTGGGYLGVFNSKEYDKTSQTVAVEFMASLQTQMISFYLIFLSILLTTIFFFKVNSTETTSFSITKFSPDQQNLIFNVLTVTLTYPNSLEEENVTSYTLNEVVPLKDVVPEWVRIGFSATTGAEFAQGDGYTTKGKLTLTKAVKSTVGRALYSTPIHIWDRDTGNVANFVTSFTFV	275	"Protein inferred from homology"	30252.81	30234.14	5.22	--NA--	"FUNCTION:D-mannose specific lectin (By similarity).SUBUNIT:Heterotetramer of two alpha and two beta chains (By similarity).PTM:The mature form consists of two chains, alpha and beta, produced by cleavage of the immature protein. These remain cleaved, yet fold together to form one subunit (By similarity).MISCELLANEOUS:Binds two manganese (or other transition metal) ions and two calcium ions per heterotetramer. The metal ions are essential for the saccharide-binding activity (By similarity).SIMILARITY:Belongs to the leguminous lectin family."
