PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4284	GDA3_WHEAT	--NA--	"Triticum aestivum"	Poaceae	--NA--	Signaling-peptide	"Allergen; Repeat; Seed storage protein; Signal; Storage protein | Alpha/beta-gliadin A-III precursor (Prolamin)."	--NA--	AHASSQVLQQSSYQQLQQLCCQQLFQIPEQSRCQAIHNVVHAIILHHHQQFPGQQEQFPPQQPYPHQQPFPSQQPYPQPQPFPPQLPYPQTQPFPPQQPYMKTFLILALLAIVATTATSAVRVPVPQLQPQNPSQQQPQEQVPLMQQQQQNLALQTLPAMCNVYIPPYCSTTIAPFGIFGTNPQPQPQYPQPQQPISQQQAQQQQQQQQTLQQILQQQLIPCRDVVLQQHNIQQQQPSSQVSYQQPQEQYPSGQVSFQSSQQNPQAQGSVQPQQLPQFQEIR	282	"Experimental evidence at transcript level"	32236.19	32216	6.76	--NA--	"FUNCTION:Gliadin is the major seed storage protein in wheat.PTM:Substrate of transglutaminase (By similarity).ALLERGEN:Causes an allergic reaction in human. Is the cause of the celiac disease, also known as celiac sprue or gluten-sensitive enteropathy (By similarity).MISCELLANEOUS:The alpha/beta-gliadins can be divided into 5 homology classes. Sequence divergence between the classes is due to single base substitutions and to duplications or deletions within or near direct repeats. There are more than a 100 copies of the gene for alpha/beta-gliadin per haploid genome.SIMILARITY:Belongs to the gliadin/glutenin family."
