PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4271	EXB15_ORYSJ	--NA--	"Oryza sativa subsp. Japonica"	Poaceae	--NA--	Signaling-peptide	"Cell wall; Cell wall biogenesis/degradation; Membrane; Secreted; Signal | Expansin-B15 precursor (OsEXPB15) (Beta-expansin-15) (OsaEXPb1.16).Secreted, cell wall; Peripheral membrane protein (By similarity)."	--NA--	AGSDGGACGYQGAVFQAPFSSMIAAGSPSIYKSGLGCGSCYQVKCTGNSACSGNPVTVVLTDECPGGPCLSEPVHFDLSGTAFGAMANPGQADQLRAAGVGWKPGMSYISTVNFLQIQYNRVPCNWGGVKLTFVVDVGSNPNYFAVLVKYENGDGDLSGVELMQMASRFQLILSTFVVIAAVTMLPRPCASIEFHRKLSSWSNGGATWYGAANGTGAGAAWTQMQQSWGAVWKLNAGSALQAPFSIRLTSSSGKTLVASNVIPS	264	"Protein inferred from homology"	27366.04	27348.26	8.12	--NA--	"FUNCTION:May cause loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found. May be required for rapid internodal elongation in deepwater rice during submergence (By similarity).SIMILARITY:Belongs to the expansin family. Expansin B subfamily.SIMILARITY:Contains 1 expansin-like CBD domain.SIMILARITY:Contains 1 expansin-like EG45 domain. "
