PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4231	GL31_ARATH	--NA--	"Arabidopsis thaliana"	Brassicaceae	--NA--	Signaling-peptide	"Apoplast; Complete proteome; Glycoprotein; Manganese; Metal-binding; Secreted; Signal | Germin-like protein subfamily 3 member 1 precursor (AtGER1) (At-GERM1),(AtGLP1).Secreted, extracellular space, apoplast (By similarity)."	--NA--	AGKSSASAVVTFNSANPGLQILDFALFANSLPTELVVGTTFLDATTVKKLFSGLGTPGNTTNIINAAVTPAFAAQFPGLNGLGLSTARLDLAPKGVIPMHKGVLGGTGMLRTIFLLSLLFALSNASVQDFCVANLKRAETPAGYPCIRPIHVKATDFVTHPGASEVLFVLTGSITAGFVSSANAVYVQTLKPGQVMVFPQGLLHFQIN	208	"Experimental evidence at protein level"	21559.06	21545.45	9.3	--NA--	"FUNCTION:May play a role in plant defense. Probably has no oxalate oxidase activity even if the active site is conserved.SUBUNIT:May not form oligomer.TISSUE SPECIFICITY:Expressed during germination, and also in green shoots, etiolated seedlings and whole seedlings.MISCELLANEOUS:Is the most highly expressed of the GLP genes.SIMILARITY:Belongs to the germin family."