PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4147	XTHA_PHAAN	--NA--	"Armoracia rusticana, Armoracia laphatifolia"	Fabaceae	--NA--	Signaling-peptide	"Apoplast; Cell wall; Cell wall biogenesis/degradation; Direct protein sequencing; Glycoprotein; Glycosidase; Hydrolase; Secreted; Signal; Transferase | Xyloglucan endotransglucosylase/hydrolase protein A precursor,(EC 2.4.1.207) (VaXTH1).Secreted, cell wall (Probable). Secreted, extracellular space, apoplast (Probabl"	--NA--	AEHDEIDFEFLGNRTGQPYILQTNVFTGGKGDREQRIYLWFDPTTQYHRYDLDAAQWQKLAWVRNKYTIYNYCTDRKRYSQVPPECTRDRDIMGSSLWTCLILLSLASASFAANPRTPIDVPFGRNYVPTWAFDHIKYLNGGSEIQLHLDKYTGTGFQSKGSYLFGHFSMYIKLVPGDSAGTVTAFYLSSTNSVLWNMYQIVFYVDDYPIRVFKNSNDLGVKFPFNQPMKIYNSLWNADDWATRGGLEKTDWSKAPFIASYKGFHIDGCEASVNAKFCDTQGKRWWDQPEFR	292	"Experimental evidence at protein level"	33882.06	33860.53	7.17	--NA--	"FUNCTION:Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET). Cleaves and religates xyloglucan polymers, an essential constituent of the primary cell wall, and thereby participates in cell wall construction of growing tissues.CATALYTIC ACTIVITY:Breaks a beta-(1->4) bond in the backbone of a xyloglucan and transfers the xyloglucanyl segment on to O-4 of the non-reducing terminal glucose residue of an acceptor, which can be a xyloglucan or an oligosaccharide of xyloglucan.TISSUE SPECIFICITY:Predominantly expressed in the phloem fibers of growing internodes. Expressed in xylem cells in the basal part of the internode. In the internode, it is expressed closer to the top of the internode compared to XTHB.INDUCTION:Up-regulated by indole-3-acetic acid (IAA) and fusicoccin. Effect of IAA is however nullified in 0.25 M mannitol, which prevents cell expansion without affecting auxin action per se.PTM:Contains at least one intrachain disulfide bond essential for its enzymatic activity (By similarity).SIMILARITY:Belongs to the glycosyl hydrolase 16 family. XTH group 1 subfamily."