PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4093	AGI_HORVU	--NA--	"Hordeum vulgare"	Poaceae	--NA--	Signaling-peptide	"Chitin-binding; Glycoprotein; Lectin; Pyrrolidone carboxylic acid; Repeat; Signal | Root-specific lectin precursor."	--NA--	ACSTDKPCGKAAGGKVCTNNYCCSKWGSCGIGPGYCGAGCQSGGCDGVFAEAIAANSTLVAEGAGCQGGPCRADIKCGSQAGGKLCPNNLCCSQWGYCGLGSEFCGEGCQGGGMGGDYCGKGCQNGACYTSKRCGTQAGGKTCPNNHCCSQWGYCGFGAEYCMKMMSTRALALGAAAVLAFAAATAHAQRCGEQGSNMECPNNLCCSQYGYC	212	"Experimental evidence at protein level"	21208.94	21193.76	7.87	--NA--	"FUNCTION:Carbohydrate binding.TISSUE SPECIFICITY:In roots.DEVELOPMENTAL STAGE:Localized to the coleorhiza, outer cell layers of the radicles, and the root caps of the developing embryo. Later found in the root tip and root cap.SIMILARITY:Contains 4 chitin-binding type-1 domains."