PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4079	NLTPX_ORYSI	--NA--	"Oryza sativa subsp. Indica"	Poaceae	--NA--	Signaling-peptide	"Lipid-binding; Signal; Transport | Non-specific lipid-transfer protein 2 precursor (nsLTP2) (7 kDa lipid,transfer protein)."	--NA--	ACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCHMMRRLAVLVLAVAMVAACGGGVVGVAGASCNAGQLTVCAGAIAGGARPTA	96	"Protein inferred from homology"	9563.24	9556.69	9.36	--NA--	"FUNCTION:Transfer lipids across membranes. May play a role in plant defense or in the biosynthesis of cuticle layers.SIMILARITY:Belongs to the plant LTP family. B11E subfamily."