PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4077	NLTP1_ORYSJ	--NA--	"Oryza sativa subsp. Japonica"	Poaceae	--NA--	Signaling-peptide	"3D-structure; Direct protein sequencing; Lipid-binding; Signal; Transport | Non-specific lipid-transfer protein 1 precursor (LTP 1) (PAPI)."	--NA--	ACCSGVRSLKAAASTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVMARAQLVLVALVAALLLAAPHAAVAITCGQVNSAVGPCLTYARGGAGPSASVPYTISASIDCSRVS	116	"Experimental evidence at protein level"	11345.22	11337.84	9.58	--NA--	"FUNCTION:Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.TISSUE SPECIFICITY:Aleurone (external part) of the seeds.SIMILARITY:Belongs to the plant LTP family.CAUTION:Was originally thought to be an inhibitor of alpha- amylase or of a protease and was known asPAPI:probable alpha- amylase/protease inhibitor."