PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_4004	NLT2B_ORYSJ	--NA--	"Oryza sativa subsp. Japonica"	Poaceae	--NA--	Signaling-peptide	"Lipid-binding; Signal; Transport | Non-specific lipid-transfer protein 2B precursor (LTP 2B) (LTP B1)."	--NA--	AACCSGVRSLNSAATTTADRRTACNCLKNVAGSISGLNAGNAASIPSKCGMARAQLVLVALVAALLLAGPHTTMAAISCGQVNSAVSPCLSYARGGSGPSVSIPYTISPSIDCSSVN	117	"Experimental evidence at transcript level"	11444.14	11436.66	8.94	--NA--	"FUNCTION:Plant non-specific lipid-transfer proteins transfer phospholipids as well as galactolipids across membranes. May play a role in wax or cutin deposition in the cell walls of expanding epidermal cells and certain secretory tissues.TISSUE SPECIFICITY:Expressed in roots, mesocotyls and devoloping leaves.INDUCTION:By abscisic acid (ABA) and salicylic acid (SA). Down- regulated by salt treatment.SIMILARITY:Belongs to the plant LTP family.SEQUENCE CAUTION:Sequence=BAF29005.1; Type=Erroneous gene model prediction; "