PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_3991	Gamma-1-purothionin	"2226781, 8380707"	"Triticum aestivum"	Poaceae	Defensin	"Protein-synthesis-inhibitor, Cytotoxic"	"inhibits protein synthesis in eukaryotic cell-free system; Shows cytotoxic activity. The toxic effect of thionins to certain strains of yeasts, high organisms and cultured cells, as well as the possibility to form immunotoxins specifically toxic to target cells of the conjugated antibody."	--NA--	KICRRRSAGFKGPCMSNKNCAQVCQQEGWGGGNCDGPFRRCKCIRQC	47	"Experimental evidence at protein level"	5239.11	5235.39	9.49	--NA--	NA