PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_3990	"Fungal growth inhibitor, Hevein, PR-4"	"2217194, 1874741, 1936279, 8431421, 9845845, doi.org/10.1080/07352689.2013.773238"	"Hevea brasiliensis"	Euphorbiaceae	Hevein	"Antimicrobial, Antifungal"	"inhibits fungal growth"	--NA--	EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKD	43	"Experimental evidence at protein level"	4727.15	4723.82	4.83	--NA--	"Participate in the innate immune response of plants, therapeutically useful as anticancer agents and novel antimicrobial compounds in the protection of crops to the disinfection of hospital environments."