PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_3972	Rs-AFP1	"1639777, 7780308, 9636715, 8422949, 25153857, 16653017"	"Raphanus sativus"	Brassicaceae	Defensin	Antifungal	"Exhibit potent antifungal activity in vitro."	"Fungi: Alternaria brassicola (IC50= 15 µg/mL), Botrytis cinerea (IC50= 8 µg/mL), Fusarium culmorum (IC50= 5 µg/mL), Fusarium oxysporum (IC50= 30 µg/mL), Pyricularia oryzae (IC50= 0.3 µg/mL), Verticiliium dahliae (IC50= 5 µg/mL). NOTE! Not tested against bacteria."	QKLCERPSGTWSGVCGNNNACKNQCINLEKARHGSCNYVFPAHKCICYFPC	51	"Experimental evidence at protein level"	5694.55	5690.56	8.72	NMR	"Signal peptide: 1-29; Mature peptide: 30-80; Activity of Rs-AFP1 to Rs-AFP3 reduced in the presence of metal ions. Note that in the structure determined by NMR, the first residue of the peptide sequence is Glu rather than Gln.You can rotate, zoom, and view the 3D structure here in the PDB . Updated 2/2014."