PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_3803	"Viphi G"	"25815333, 21723349"	"Viola philippica"	Violaceae	Cyclotide	"Anticancer, Cytotoxic, Antimicrobial"	"Shows innate immune defense mechanism to treat infections caused by pathogenic bacteria to animals and humans. Display anticancer activities because of their ability to inactivate a wide range of cancer cells. Induce the production of reactive oxygen species (ROS) and cell membrane permeabilization"	"MM96L, HeLa, BGC-823, and HFF-1"	GSIPCEGSCVFIPCISAIIGCSCSNKVCYKN	31	"Experimental evidence at protein level"	3196.79	3194.44	7.77	--NA--	"Activity tested together with Viphi F."