PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_3749	Potamin-1	15809084	"Solanum tuberosum"	Solanaceae	--NA--	"Antimicrobial, Antifungal, Enzyme-inhibitor"	"Shows antimicrobial, protease inhibitory and antifungal activity but lacked hemolytic activity. It strongly inhibited pathogenic microbial strains. It is also used as an excellent candidate of a lead compound for the development of novel oral or other anti-infective agents."	--NA--	DICTCCAGTKGCNTTSANGAFICEGQSDPKKPKACPLNCDPHIAYA	46	"Experimental evidence at protein level"	4719.36	4716.07	6.7	--NA--	"Warning: only the C-terminal amino acid sequence is reported. Active against C. albicans, R. solani, and C. michiganense subsp. michiganinse. Enzyme inhibitor."