PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_3505	HyPep	25750185	"Capsicum annuum"	Solanaceae	--NA--	"Alpha-amylase-inhibitor, Antifungal"	"The S3 fraction showed the highest antifungal activity, inhibiting all the yeast strains tested, and it also exhibited inhibitory activity against human salivary and Callosobruchus maculatus ±-amylases as well as serine proteinases."	"C. albicans (IC50= 25 µM), K. marxianus (IC50= 25 µM), Trypsin (IC50= 28 µM)"	NCDTDIAYMVCPSSGERIIRKVCTNCCAAQKGCCKLFRSNGSIKCTGT	48	"Experimental evidence at protein level"	5151.02	5147.35	8.73	--NA--	NA