PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_3496	DEF2	23412850	"Solanum lycopersicum"	Solanaceae	Defensin	Antimicrobial	"AMPs constitute a primitive mechanism of innate immunity and help as defense to protect their hosts from microbial attack. Influence of pollen viability and seed production."	--NA--	MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL	50	"Experimental evidence at protein level"	5587.47	5584.02	6.08	--NA--	NA