PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_3477	BrD1	19714315	"Brassica rapa"	Brassicaceae	Defensin	Insecticidal	"Exhibits insecticidal activity, and used for developing cereal crop plants resistant to sap-sucking insects, such as the brown planthopper."	--NA--	MAKFVSIITLFFAALVLFAAFEAPTMVKAQKLCERSSGTWSGVCGNNNACKNQCINLEGARHGSCNYVFPYHRCICYFPC	80	"Experimental evidence at protein level"	8864.38	8858.22	8.7	--NA--	NA