PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_3410	"Ah-AMP 1"	7628617	"Aesculus hippocastanum"	Hippocastanaceae	--NA--	Antimicrobial	"Inhibition of in vitro protein synthesis and inhibition of ±-amylases. It also show antimicrobial activity."	"Fungi and bacteria"	LCNERPSQTWSGNCGNTAHCDKQCQDWEKASHGACHKRECFCYFNC	46	"Experimental evidence at protein level"	5297.85	5294.14	6.96	"RP-HPLC, SDS-PAGE"	NA