PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_3380	"Phoratoxins B"	25815333	"Phoradendron tomentosum"	Santalaceae	Thionin	Anticancer	"Shows innate immune defense mechanism to treat infections caused by pathogenic bacteria to animals and humans. Display anticancer activities because of their ability to inactivate a wide range of cancer cells. Induce the production of reactive oxygen species (ROS) and cell membrane permeabilization"	Mice	KSCCPTTTARNIYNTCRFGGGSRPICAKLSGCKIISGTKCDSNGWDH	47	"Experimental evidence at protein level"	5009.72	5006.33	9.13	--NA--	NA