PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_3364	MtDef5B	29867843	"Medicago truncatula"	Fabaceae	Defensin	"Antimicrobial, Antibacterial, Antifungal"	"Shows both antifungal and antibacterial activity. MtDef5 and its more potent single domain MtDef5B have the potential to be deployed as antibacterial agents for control of a Xanthomonas wilt disease in transgenic crops."	"Xanthomonas campestris (MIC= 6 µM), Clavibacter michiganensis (MIC= >12 µM)"	KLCERRSKTWSGPCLISGNCKRQINVEHATSGACHRQGIGFACFCKKKC	49	"Experimental evidence at protein level"	5442.4	5438.65	9.54	--NA--	NA