PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_3090	PA1b	20660598	"Pisum sativum"	Fabaceae	Knottin	Insecticidal	"It acts as a potent insecticidal agent against major pests in stored crops and vegetables, making it a promising bioinsecticide."	--NA--	ASCNGVCSPFEMPPCGTSACRCIPVGLVIGYCRNPSG	37	"Experimental evidence at protein level"	3747.39	3744.65	7.81	"RP-HPLC and MALDI-TOF"	NA