PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_3089	WAMP-4	25154438	Aegilops-speltoides	Poaceae	--NA--	Antimicrobial	"This block the fungalysin activity, keeping the chitinase intact. Thus, WAMPs represent novel protease inhibitors that are active against fungal metalloproteases. WAMPs directly inhibited hyphal elongation, and plays an important role in fungal development. Degradation of chitin cell wall."	"F. verticillioides (IC50= 3.0 ±0.28 µM)"	AQRCGDQARGAKCPNCLCCGKYGFCGSGDAYCGNGSCQSQCRGCR	45	"Experimental evidence at protein level"	4644.23	4640.84	8.62	--NA--	NA