PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2996	OsDEF8	27527801	"Oryza sativa"	Poaceae	--NA--	"Antimicrobial, Antibacterial, Antifungal"	"active against Gram-negative bacteria (Xanthomonas oryzae, MIC=3.9 µg/mL and Erwinia carotovora, MIC=63 µg/mL); fungus (Harpophora oryzae, MIC=15 µg/mL)."	--NA--	RTCESQSHRFKGPCARKANCASVCNTEGFPDGYCHGVRRRCMCTKPCP	48	"Experimental evidence at protein level"	5350.16	5346.37	9.12	--NA--	"APD analysis reveals that the sequence of this peptide shows 72.9% similarity to defensin P322. Molecular formula: C217H350N74O65S9; Mol Wt 5350.212; GRAVY= -0.804; Wimley-White whole-residue hydrophobicity of the peptide: 12.81 kcal/mol. Active against X. oryzae pv. oryzae, X. oryzae pv. oryzicola (causing a serious blight of rice) (MIC 3.9, 0.6 ug/mL), E. carotovora (MIC 63 ug/mL), fungi H. oryzae (MIC 15 ug/mL)."