PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2815	"Inhibitor of insect alpha-amilase SIa-2"	1995329	"Sorghum vulgare, Sorghum bicolor"	Poaceae	--NA--	Enzyme-inhibitor	"strongly inhibits the alpha-amylases from the guts of locust and cockroach"	--NA--	RVCMGKSAGFKGLCMRDQNCAQVCLQEGWGGGNCDGVMRQCKCIRQCW	48	"Experimental evidence at protein level"	5316.26	5312.33	8.75	--NA--	NA
