PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2791	Palicourein	11430013	"Palicourea condensata"	Rubiaceae	--NA--	"Antimicrobial, Antiviral"	"inhibits the in vitro cytopathic effects of HIV-IRF infection of CEM-SS cells with an EC50 value of 0.1 µM and an IC50 value of 1.5 µM"	--NA--	RNGDPTFCGETCRVIPVCTYSAALGCTCDDRSDGLCK	37	"Experimental evidence at protein level"	3928.43	3925.7	4.78	--NA--	NA