PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_265	Flo	--NA--	"Moringa oleifera"	Moringaceae	Cationic	Antibacterial	--NA--	--NA--	QGPGRQPDFQRCGQQLRNISPPQRCPSLRQAVQLTHQQQGQVGPQQVRQMYRVASNIPST	60	"Experimental evidence at protein level"	6781.63	6777.43	11.61	--NA--	"APD analysis reveals that the sequence is 31.2% similar to tick Ixodidin. Active against S. aureus, S. pyogenes (MIC 2-5 mg/mL), S. mitis, E. faecalis, E. coli (MIC 10 mg/mL), S. pneumoniae (MIC 1), and L. pneumophila. The peptide was initially isolated and characterized as a flocculating protein (Gassenschmidt U et al., 1995). The N-terminal E is a pyroglutamate (XXQ). Thus, attempts were made to adsorb this protein to sand granules for clarifying and disinfecting water (Jerri HA et al., 2012). CryoEM experiments observed that MOCP fused the inner and outer membranes of E. coli (Shebek K et al., 2015). "