PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_262	"Viscotoxin A2"	--NA--	"Viscum album"	Santalaceae	Thionin	Anticancer	--NA--	--NA--	KSCCPNTTGRNIYNTCRFGGGSRQVCASLSGCKIISASTCPSDYPK	46	"Experimental evidence at protein level"	4833.5	4830.22	9.13	NMR	"Mistletoe extracts have immunomodulatory activity by increasing natural killer (NK) cell-mediated killing of tumor cells but spare nontarget cells from NK lysis (Tabiasco et al., 2002). You can rotate, zoom, and view the 3D structure here in the PDB . Updated 2/2014."