PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2597	"Hellethionin A"	12600207	"Helleborus purpurascens"	Ranunculaceae	--NA--	Toxin	"is toxic to animal cells. It seems to exert its toxic effect at the level of the cell membranes."	--NA--	KSCCRNTLGRNCYNGCRFTGGSQPTCGRLCDCIHVTTTTCPSSHPS	46	"Experimental evidence at protein level"	4924.56	4921.13	8.76	--NA--	NA
