PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_252	MsSN-1	--NA--	"Medicago sativa"	Fabaceae	Snakin	"Antibacterial, Antifungal"	--NA--	--NA--	GTDSGRFCSSICGQRCSKAGMKDRCMKFCGICCGKCKCVPSGTYGNKHECPCYRDMKNSKGKPKCP	66	"Experimental evidence at protein level"	7167.46	7162.15	9.2	--NA--	"This peptide was found from alpalfa, an ancient plant of ~8000 years old, which is good for agriculture. Active against P. fluorescens, B. japonicum, M. loti, R. etli CFN 42, S. medicae, and S. fredii. Transgenic plants: MsSN1-overexpressing transgenic plants showed nodule production of S. meliloti comparable with that of the wild type plants. Reg. 9/23/2014. "