PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_247	DC1	--NA--	"Hedyotis diffusa"	Rubiaceae	Cyclotide	Anticancer	--NA--	--NA--	GAFLKCGESCVYLPCLTTVVGCSCQNSVCYRD	32	"Experimental evidence at protein level"	3419.98	3417.5	6.03	--NA--	"APD analysis reveals that the sequence of this peptide most resembles (68.7% similarity) Cycloviolin C. Mol. Wt: 3414.0; GRAVY=0.506. Kill human prostate cancer cells: LNcap (IC50 5.03 uM), PC3 (2.24 uM) and DU145 (3.32 uM). "