PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2354	"Elicitor peptide AtPep2"	16785434	"Arabidopsis thaliana"	Brassicaceae	--NA--	"Antimicrobial, Antifungal"	"induces the production of plant defensin (PDF1.2) and of H(2)O(2). Promotes resistnce to the root fungal pathogen Pythium irregulare."	--NA--	DNKAKSKKRDKEKPSSGRPGQTNSVPNAAIQVYKED	36	"Experimental evidence at protein level"	3972.39	3970.06	9.78	--NA--	NA