PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2299	"Putative Rapid alkalinization factor, RALF"	11675511	"Mesembryanthemum crystallinum"	Aizoaceae	--NA--	RALF-Rapid-alkalinization-factor	"causes an arrest of root growth and development when supplies to germinating tomato and Arabidopsis seeds"	--NA--	ATNSYISYGALNKNRVPCSRRGASYYNCRPGAQANPYSRGCSRITRCRP	49	"Experimental evidence at protein level"	5458.13	5454.63	10.31	--NA--	NA
