PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2225	Cycloviolacin-O3	"28669767, 10600388, 16872274"	"Viola odorata"	Violaceae	Cyclotide	"Antibacterial, Anticancer, Antifungal, Antiparasitic, Nematocide"	"participates in a plant defense mechanism; The cycloviolacin O3 showed significant activity in inhibiting development of nematode larvae, Target site- Lipid Bilayer"	"Escherichia coli (MBC50: 5 µM), Escherichia coli (MBC99: 10 µM), Escherichia coli (MIC: 10 µM), Pseudomonas aeruginosa (MBC50: 5 µM), Pseudomonas aeruginosa (MBC99: 5 µM), Pseudomonas aeruginosa (MIC: 10 µM), Staphylococcus aureus (MBC50: 5 µM), Staphylococcus aureus (MBC99: 10 µM), Staphylococcus aureus (MIC: 20 µM), Candida albicans (MFC50: 10 µM), Candida albicans (MIC: 20 µM), Candida albicans (MFC99: 10 µM), Human histiocytic lymphoma U-937/GTB(IC50: 0.42 µM)"	GIPCGESCVWIPCLTSAIGCSCKSKVCYRN	30	"Experimental evidence at protein level"	3178.78	3176.44	8.33	--NA--	"Synthesis Type: Ribosomal, Active against nematode parasites of sheep (e.g. Haemonchus contortus or Trichostrongylus colubriformis); cross link- SWISS P58435, PHYT00178"