PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2224	Ligatoxin-B	"12049612, 25815333"	"Phoradendron liga"	Santalaceae	Thionin	"Anticancer, Toxin"	"Target site: lipid bilayer, DNA / RNA; Shows innate immune defense mechanism to treat infections caused by pathogenic bacteria to animals and humans. Display anticancer activities because of their ability to inactivate a wide range of cancer cells. Induce the production of reactive oxygen species (ROS) and cell membrane permeabilization ; is toxic to animal cells"	"Human histiocytic lymphoma U-937/GTB (IC50: 1.8 µM), Human renal adenocarcinoma ACHN (IC50: 3.2 µM)"	KSCCPSTTARNIYNTCRLTGASRSVCASLSGCKIISGSTCDSGWNH	46	"Experimental evidence at protein level"	4798.41	4795.18	8.94	--NA--	"Synthesis Type : Ribosomal"