PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2221	"Defensin-like protein 1, Defensin AMP1, Ah-Amp1"	"10591099, 7628617"	"Aesculus hippocastanum"	Sapindaceae	Defensin	"Antibacterial, Antifungal"	"is active against fungi, Target site: lipid bilayer"	"Botrytis cinerea (IC50: 25 µg/ml), Botrytis cinerea (IC50: >100 µg/ml), Cladosporium sphaerospermum (IC50: 0.5 µg/ml), Cladosporium sphaerospermum (IC50: 12 µg/ml), Fusarium culmorum (IC50: 12 µg/ml), Fusarium culmorum (IC50: >100 µg/ml), Fusarium culmorum (IC50: 0.7 µg/ml), Fusarium culmorum (IC50: >50 µg/ml), Fusarium culmorum (IC50: 22 µg/ml), Neurospora crassa (IC50: 0.5 µg/ml), Neurospora crassa (IC50: 3.3 µg/ml), Neurospora crassa (IC50: 18 µg/ml), Neurospora crassa (IC50: 0.8 µg/ml), Neurospora crassa (IC50: 4 µg/ml), Leptosphaeria maculans (IC50: 0.5 µg/ml), Leptosphaeria maculans (IC50: 6 µg/ml), Penicillium digitatum (IC50: 6 µg/ml), Penicillium digitatum (IC50: 25 µg/ml), Trichoderma viride (IC50: >100 µg/ml), Septoria tritici (IC50: 1.5 µg/ml), Verticillium alboatrum (IC50: 6 µg/ml), Verticillium albo-atrum (IC50: >100 µg/ml), Bacillus subtilis (IC50: 100 µg/ml), Escherichia coli, Micrococcus luteus, Proteus vulgaris, Staphylococcus aureus, Streptococcus faecalis"	LCNERPSQTWSGNCGNTAHCDKQCQDWEKASHGACHKRENHWKCFCYFNC	50	"Experimental evidence at protein level"	5863.48	5859.42	7.73	NMR	"Mature peptide: 1-50, Synthesis Type : Ribosomal, In medium A supplemented with 1 mM CaCl2 and 50 mM KCl, the peptide is active against fungi B. cinerea (IC50 25 ug/ml), C. sphaerospermum (IC50 0.5 ug/ml), F. culmorum (IC50 12 ug/ml), L. maculans (IC50 0.5 ug/ml), P. digitatum (IC50 6 ug/ml), S. tritici (IC50 0.5 ug/ml), and V. albo-atrum (IC50 6 ug/ml) (FEBS Lett. 1995 Jul 17;368(2):257-62). 3D structure was determined by Fant F et al. (Proteins 1999; 37(3): 388-403). You can rotate, zoom, and view the 3D structure here in the PDB . Major ref updated 7/2013; 2/2014; Jan2017."