PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2219	"Floral defensin-like protein 1 / PhD1"	"12644678, 12644678, 12846570"	"Petunia hybrida"	Solanaceae	Defensin	"Antibacterial, Antifungal"	"may have antimicrobial activity,Target site: lipid bilayer"	"Fungi: Fusarium oxysporum(IC50= 10 µg/ml) and Botrytis cinerea (IC50= 10 µg/ml). NOTE! Not tested against bacteria."	ATCKAECPTWDSVCINKKPCVACCKKAKFSDGHCSKILRRCLCTKEC	47	"Experimental evidence at protein level"	5211.27	5207.44	8.9	NMR	"Synthesis Type : Ribosomal; It can form 5 S-S bonds. You can rotate, zoom, and view the 3D structure here in the PDB. Updated 2/2014., shows 56% Inhibition against Fusarium oxysporum at 2 ¼g/ml|shows 100% Inhibition against Fusarium oxysporum at 10 ¼g/ml|shows 0% Inhibition against Botrytis cinerea at 2 ¼g/ml|shows 70% Inhibition against Botrytis cinerea at 10 ¼g/ml, Signal peptide: 1-25; Mature peptide: 26-72; Proprotein: 73-103"