PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2215	"Circulin-B, CIRB"	"4303114, 8920961, 10430870"	"Chassalia parvifolia"	Rubiaceae	Cyclotide	"Antibacterial, Antifungal, Hemolytic, Cytotoxic, Antiviral, Insecticidal, Anti-HIV"	"Circulin B shown to possess some anti-bacterial and anti-HIV activity, Target site: lipid bilayer; 50% Hemolysis against Human erythrocytes at 550 µM; Mouse fibroblasts(IC50: 820 µM), is active against Gram-positive and Gram-negative bacteria; inhibits cytopathic effects and replication of the HIV"	"Escherichia coli (MIC: 0.41 µM), Escherichia coli (MIC: >500 µM ), Pseudomonas aeruginosa (MIC: 25.5 µM), Pseudomonas aeruginosa (MIC: 48.0 µM), Proteus vulgaris (MIC: 6.80 µM), Proteus vulgaris (MIC: >500 µM), Klebsiella oxytoca (MIC: 8.20 µM), Klebsiella oxytoca (MIC: 15.6 µM), Staphylococcus aureus (MIC: 13.5 µM), Staphylococcus aureus (MIC: >500 µM), Micrococcus luteus (MIC: >500 µM), Candida albicans (MIC: >500 µM), Candida kefyr (MIC: 29.0 µM), Candida kefyr (MIC: >500 µM), Candida tropicalis (MIC: >500 µM)"	GVIPCGESCVFIPCISTLLGCSCKNKVCYRN	31	"Experimental evidence at protein level"	3307.98	3305.56	8.33	NMR	"Synthesis Type : Ribosomal, It is cyclic and contains three disulfide bonds (Tam JP et al. Proc. Natl. Acad. Sci. U.S.A. 1999; 96: 8913-8918).You can rotate, zoom, and view the 3D structure here in the PDB . Updated 8/10/2015."