PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2190	Circulin-E	10691702	"Chassalia parvifolia"	Rubiaceae	Cyclotide	"Antiviral, Anti-HIV"	"Target site: lipid bilayer; Circulins E inhibited the cytopathic effects of in vitro HIV-1 infection."	"HIV-1 (EC50: 0.050-0.275 µM)"	KIPCGESCVWIPCLTSVFNCKCENKVCYHD	30	"Experimental evidence at protein level"	3420.03	3417.51	6.71	--NA--	"Synthesis Type : Ribosomal|Inhibition of the cytopathic effects of HIV-1 infection"
