PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2189	Palicourein	"11430013, 14725768"	"Palicourea condensata"	Rubiaceae	Cyclotide	"Antiviral, Anti-HIV"	"Target site: lipid bilayer, Palicourein shown to have anti-HIV properties."	"HIV-1RF (EC50: 0.1 µM), HIV-1RF (IC50: 1.5 µM)"	GDPTFCGETCRVIPVCTYSAALGCTCDDRSDGLCKRN	37	"Experimental evidence at protein level"	3928.43	3925.7	4.78	"Amino acid analysis, MS, NMR"	"Synthesis Type : Ribosomal|Inhibition of the cytopathic effects of HIV-1RF infection in a human T-lymphoblastoid cell line (CEM-SS)|Inhibition of the cytopathic effects of HIV-1RF infection in a human T-lymphoblastoid cell line (CEM-SS); Largest known cyclotide to date."