PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2178	"Sm AMP-1.1a"	26196691	"Stellaria media"	Caryophyllaceae	Hevein	Antifungal	"Target site- Lipid Bilayer, It exhibits potent antifungal activity against important plant pathogens in the micromolar range. It is also represent an important player In the plant immune system."	"Botrytis cinerea (IC50: 2.4 µM), Fusarium solani (IC50: 3.5 µM), Alternaria alternata (IC50: 2.6 µM)"	SGPNGQCGPGWGGCRGGLCCSQYGYCGSGPKYCAH	35	"Experimental evidence at protein level"	3468.85	3466.36	8.29	--NA--	"Synthesis Type: Ribosomal; Chitin-binding peptide"