PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2175	"Defensin AMP2 / DmAMP2"	"7628617, 14604982, 10656585, 10931938, 13129623, 17216480"	"Dahlia merckii"	Asteraceae	Defensin	"Antibacterial, Antifungal"	"Target site: lipid bilayer, Dahlia merckii defensin AMP1. Cysteine-rich antimicrobial protein 1, AMPs constitute a primitive mechanism of innate immunity and help as defense to protect their hosts from microbial attack."	"Botrytis cinerea (IC50: 10 µg/ml), Botrytis cinerea (IC50: >100 µg/ml), Cladosporium sphaerospermum (IC50: 3 µg/ml), Cladosporium sphaerospermum (IC50: 12 µg/ml), Fusarium culmorum (IC50: 3 µg/ml), Fusarium culmorum (IC50: 12 µg/ml), Leptosphaeria maculans (IC50: 1 µg/ml), Leptosphaeria maculans (IC50: 20 µg/ml), Penicillium digitatum (IC50: 2 µg/ml), Penicillium digitatum (IC50: 50 µg/ml), Trichoderma viride (IC50: >100 µg/ml), Septoria tritici (IC50: 1 µg/ml), Septoria tritici (IC50: 2 µg/ml), Verticillium alboatrum (IC50: 2 µg/ml), Verticillium albo-atrum (IC50: >100 µg/ml)"	ELCEKASKTWSGNCGNTGHCDNQCKSWEGAAHGACHVRNGKHMCFCYFNC	50	"Experimental evidence at protein level"	5525.17	5521.25	7.8	--NA--	"Synthesis Type : Ribosomal, Mature peptide: 1-50, In medium A supplemented with 1 mM CaCl2 and 50 mM KCl, the peptide is active against fungi B. cinerea (IC50 12 ug/ml), C. sphaerospermum (IC50 3 ug/ml), F. culmorum (IC50 5 ug/ml), L. maculans (IC50 1.5 ug/ml), P. digitatum (IC50 2 ug/ml), S. tritici (IC50 1 ug/ml), and V. albo-atrum (IC50 4 ug/ml) (FEBS Lett. 1995 Jul 17;368(2):257-62). It contains 4 S-S bonds. Binding of Dm-AMP1 to S. cerevisiae plasma membranes is required for antifungal activity of this protein (Mol Plant Microbe Interact. 2000;13:54-61). Specifically, it directly binds to mannosyldiinositolphosphoryl-ceramide [M(IP)2C], an acid complex sphigolipid (Thevissen K et al 2000 PNAS USA 97: 9531-6). The lack of the gene that encodes the enzyme required for the synthesis of this lipid increased resistance against Dm-AMP1. Transgenic plants: expression of this peptide in Eggplant improves resistance to pathogens (Montesinos E 2007 FEMS Microbiol Lett 270, 1-11). UPdated Jan2017."