PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2160	"Cter G"	"28669767, 21194241"	"Clitoria ternatea"	Fabaceae	Cyclotide	"Antibacterial, Anticancer, Antifungal, Insecticidal, Hemolytic, Anthelmintic, Cytotoxic"	"Target site- Lipid Bilayer; Shown to possess various antimicrobial and cytotoxic activities."	"Escherichia coli (MBC50: 10 µM), Escherichia coli (MBC99: 20 µM), Escherichia coli (MIC: 40 µM), Escherichia coli (MIC: >160 µM), Escherichia coli (MIC: >160 µM), Escherichia coli (MIC: >160 µM), Pseudomonas aeruginosa (MBC50: 0.313 µM), Pseudomonas aeruginosa (MBC99: 0.625 µM), Pseudomonas aeruginosa (MIC: 0.625 µM), Pseudomonas aeruginosa (MIC: 160 µM), Pseudomonas aeruginosa (MIC: 160 µM), Staphylococcus aureus (MBC50: 40 µM), Staphylococcus aureus (MBC99: 160 µM), Staphylococcus aureus (MIC: >160 µM), Candida albicans (MFC50: 40 µM), Candida albicans (MFC99: 80 µM), Candida albicans (MIC: 160 µM), Human histiocytic lymphoma U-937/GTB(IC50: 3.0 µM)"	GLPCGESCVFIPCITTVVGCSCKNKVCYNN	30	"Experimental evidence at protein level"	3152.74	3150.41	7.77	"MS, Amino acid analysis"	"Synthesis Type: Ribosomal"