PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2146	"Antimicrobial peptide 2, ToAMP2"	22640720	"Taraxacum officinale"	Asteraceae	"Cysteine rich peptides"	"Antibacterial, Antifungal"	"Target site- Lipid Bilayer"	"Fusarium oxysporum, Fusarium graminearum, Botrytis cinerea (IC50: 5.2 µM), Aspergillus niger (IC50: 2.6 µM), Pythium debaryanum (IC50: 2.6 µM), Bipolaris sorokiniana (IC50: 5.2 µM)"	GGKCTVDWGGQGGGRRLPSPLFCCYKPTRICYLNQETCETETCP	44	"Experimental evidence at protein level"	4826.5	4823.18	7.77	--NA--	"Synthesis Type: Ribosomal; Not active up to 10 µM- Fusarium oxysporum, Fusarium graminearum; Also active against P. syringae B. subtilis X. campestris, Clavibacter michiganense (inhibition is given in cm) and P. infestans (suppression of development)"