PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2131	"Cliotide T14"	27007913	"Clitoria ternatea"	Fabaceae	Cyclotide	Antibacterial	"Target site- Lipid Bilayer, Shown to possess anti-bacterial activity."	"Escherichia coli (MIC: >100 µM), Staphylococcus aureus"	DTIPCGESCVWIPCISSILGCSCKDKVCYHN	31	"Experimental evidence at protein level"	3374.94	3372.48	5.38	MS	"Synthesis Type: Ribosomal; Not active up to 100 µM- Staphylococcus aureus/ Cationic cliotides display potent antibacterial activity against Gram-negative bacteria. It also possess prominent immunostimulating activity. Cationic cliotides are capable of secretion of various cytokines and chemokines in human monocytes at both resting and lipopolysaccharide-stimulated states. Hence also used as potential candidates for novel immunomodulating therapeutics."
