PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2129	"Viphi A"	"21723349, 25815333"	"Viola philippica"	Violaceae	Cyclotide	"Anticancer, Antimicrobial, Cytotoxic"	"Shown to possess highly cytotoxic activity against cancer cell lines.; Target site- Lipid Bilayer; Shows innate immune defense mechanism to treat infections caused by pathogenic bacteria to animals and humans. Display anticancer activities because of their ability to inactivate a wide range of cancer cells. Induce the production of reactive oxygen species (ROS) and cell membrane permeabilization"	"Human skin melanoma MM96L(IC50: 4.91 ±0.04 µM), Human cervical carcinoma HeLa(IC50: 15.5 ±0.06 µM), Human gastric cancer BGC-823(IC50: 1.75 ±0.05 µM); Human foreskin fibroblasts HFF-1(IC50: 3.19 ±0.01 µM)"	GSIPCGESCVFIPCISSVIGCACKSKVCYKN	31	"Experimental evidence at protein level"	3196.84	3194.48	8.33	MS	"Synthesis Type: Ribosomal; Activity tested together with Mram 8."
