PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2126	"Cliotide T1"	"26668107, 21596752, 25815333"	"Clitoria ternatea"	Fabaceae	Cyclotide	"Antibacterial, Anticancer, Cytotoxic, Antimicrobial, Immunomodulatory, Nematocide, Hemolytic"	"Target site: lipid bilayer; shows 50% Hemolysis against Human erythrocytes at 7.1 µM; Shows innate immune defense mechanism to treat infections caused by pathogenic bacteria to animals and humans. Display anticancer activities because of their ability to inactivate a wide range of cancer cells. Induce the production of reactive oxygen species (ROS) and cell membrane permeabilization"	"Staphylococcus aureus (MIC: >100 µM), Enterococcus faecalis (MIC: >100 µM), Escherichia coli (MIC: 1.1 µM), Pseudomonas aeruginosa (MIC: 2.7 µM), Klebsiella pneumoniae (MIC: 4.7 µM), Human cervical carcinoma HeLa (IC50: 0.6 µM)"	GIPCGESCVFIPCITGAIGCSCKSKVCYRN	30	"Experimental evidence at protein level"	3109.72	3107.42	8.33	"Amino acid analysis, NGS, PcR, MS"	"Synthesis Type : Ribosomal, High general expression in C. ternatea. (Gilding et al., 2016), Cliotides T5 to T12 have not been collected into the APD owing to the lack of activity data. Heat stable."