PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2122	"Viphi E"	21723349	"Viola philippica"	Violaceae	Cyclotide	"Anticancer, Antimicrobial, Cytotoxic"	"Target site- Lipid Bilayer; Shown to possess highly cytotoxic activity against cancer cell lines."	"Human skin melanoma MM96L(IC50: 2.51 ±0.03 µM), Human cervical carcinoma HeLa(IC50: 5.24 ±0.40 µM), Human gastric cancer BGC-823; Human foreskin fibroblasts HFF-1(IC50: 1.55 ±0.09 µM);"	GSIPCGESCVFIPCISAVIGCSCSNKVCYKN	31	"Experimental evidence at protein level"	3182.77	3180.42	7.77	MS	"Synthesis Type: Ribosomal, Activity tested together with Viphgi D."