PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2092	Hc-AFP1	22032337	"Heliophila coronopifolia"	Brassicaceae	Knottin	Antifungal	"Target site- Lipid Bilayer"	"Botrytis cinerea(IC50: >25 µg/ml), Fusarium solani(IC50: >25 µg/ml)"	RYCERSSGTWSGVCGNSGKCSNQCQRLEGAAHGSCNYVFPAHKCICYYPC	50	"Experimental evidence at transcript level"	5483.16	5479.32	8.5	--NA--	"Synthesis Type: Ribosomal; Activity is associated with membrane permeabilization; Hc-AFP1 and 3 had a mild morphogenetic effect on the fungus, without any indication of membrane activity. Hc-AFP1 and 3 expressed in mature leaves, stems and flowers."
