PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2088	Ac-AFP4	22032337	"Heliophila coronopifolia"	Brassicaceae	Knottin	Antifungal	"Target site- Lipid Bilayer"	"Botrytis cinerea(IC50: 15-20 µg/ml), Fusarium solani(IC50: 5-10 µg/ml)"	QKLCERPSGTWSGVCGNNGACRNQCIRLERARHGSCNYVFPAHKCICYFPC	51	"Experimental evidence at transcript level"	5735.61	5731.61	8.94	--NA--	"Synthesis Type: Ribosomal; only Hc-AFP2 and 4 caused membrane permeabilization and severe hyper-branching against the wilting pathogen Fusarium solani.Hc-AFP2 and 4 exclusively expressed in seedpods and seeds. "