PPepDB-ID	"Peptide Name"	PMID	"Plant source"	"Plant Family"	"Peptide Family"	"Peptide function"	"Peptide function description"	"Activity against"	Sequence	"Sequence Length"	Validation	"Avg. Molecular wt(Da)"	"Monoisotopic molecular wt(Da)"	pI	Method	"Additional information"
PPepDB_2086	"Sugarcane defensin 5, Sd5"	18618271	"Saccharum officinarum"	Poaceae	Defensin	"Antibacterial, Antifungal"	"Target site- Lipid Bilayer"	"Kocuria rhizophila, Bacillus subtilis, Escherichia coli, Staphylococcus aureus, Neurospora crassa(IC50: 15 µM), Aspergillus niger(IC50: >20 µM), Fusarium solani(IC50: 10 µM)"	HTPTPTPICKSRSHEYKGRCIQDMDCNAACVKESESYTGGFCNGRPPFKQCFCTKPCKRERAAATLRWPGL	71	"Experimental evidence at protein level"	7967.16	7961.74	9.05	NMR	"Synthesis Type: Ribosomal; Provided by A.P. Valente 8/2/2012. You can rotate, zoom, and view the 3D structure here in the PDB . Updated 2/2014."